Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197100_WB13.jpg WB (Western Blot) (WB Suggested Anti-FADD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

Rabbit anti-Mouse FADD Polyclonal Antibody | anti-FADD antibody

FADD antibody - C-terminal region

Gene Names
Fadd; Mort1/FADD
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FADD, Antibody; FADD antibody - C-terminal region; anti-FADD antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASVAGLVKALRTCRLNLVADLVEEAQESVSKSENMSPVLRDSTVSSSETP
Sequence Length
205
Applicable Applications for anti-FADD antibody
WB (Western Blot)
Homology
Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse FADD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FADD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

product-image-AAA197100_WB13.jpg WB (Western Blot) (WB Suggested Anti-FADD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SP2/0 cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: FADDSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA197100_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: FADDSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)
Related Product Information for anti-FADD antibody
This is a rabbit polyclonal antibody against Fadd. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Fadd is apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis.
Product Categories/Family for anti-FADD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
FAS-associated death domain protein
NCBI Official Synonym Full Names
Fas (TNFRSF6)-associated via death domain
NCBI Official Symbol
Fadd
NCBI Official Synonym Symbols
Mort1/FADD
NCBI Protein Information
FAS-associated death domain protein
UniProt Protein Name
Protein FADD
UniProt Gene Name
Fadd
UniProt Synonym Gene Names
Mort1
UniProt Entry Name
FADD_MOUSE

Similar Products

Product Notes

The FADD fadd (Catalog #AAA197100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FADD antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FADD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FADD fadd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASVAGLVKAL RTCRLNLVAD LVEEAQESVS KSENMSPVLR DSTVSSSETP. It is sometimes possible for the material contained within the vial of "FADD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.