Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Host: MouseTarget Name: FAHSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Rabbit FAH Polyclonal Antibody | anti-FAH antibody

FAH antibody - C-terminal region

Reactivity
Tested: Human, Mouse; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
FAH; Polyclonal Antibody; FAH antibody - C-terminal region; anti-FAH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human, Mouse; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-FAH antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Gene Symbol
FAH
Protein Size (# AA)
419 amino acids
Official Gene Full Name
Fumarylacetoacetate hydrolase (fumarylacetoacetase)
Blocking Peptide
For anti-FAH antibody
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
Peptide Sequence
Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Protein Name
Fumarylacetoacetase
Protein Interactions
KRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR;
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Replacement Item
This antibody may replace item sc-62356 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: MouseTarget Name: FAHSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: MouseTarget Name: FAHSample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(FAH antibody - C-terminal region validated by WB using Jurkat cell lysate at 2.5 ug/ml.)

WB (Western Blot) (FAH antibody - C-terminal region validated by WB using Jurkat cell lysate at 2.5 ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: Human Liver and Mouse FAH KO liverPrimary Dilution: 1:400)

IHC (Immunohistochemistry) (Sample Type: Human Liver and Mouse FAH KO liverPrimary Dilution: 1:400)

IHC (Immunohistochemistry)

(Rabbit Anti-FAH AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry) (Rabbit Anti-FAH AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Immunohistochemistry with human liver, mouse KO tissue)

IHC (Immunohistochemistry) (Immunohistochemistry with human liver, mouse KO tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with human liver, mouse KO tissue)

IHC (Immunohistochemistry) (Immunohistochemistry with human liver, mouse KO tissue)
Related Product Information for anti-FAH antibody
Description of Target: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
fumarylacetoacetase
NCBI Official Synonym Full Names
fumarylacetoacetate hydrolase
NCBI Official Symbol
FAH
NCBI Protein Information
fumarylacetoacetase
UniProt Protein Name
Fumarylacetoacetase
UniProt Gene Name
FAH
UniProt Synonym Gene Names
FAA
UniProt Entry Name
FAAA_HUMAN

Similar Products

Product Notes

The FAH fah (Catalog #AAA23495) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAH antibody - C-terminal region reacts with Tested: Human, Mouse; Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FAH can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE). Researchers should empirically determine the suitability of the FAH fah for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.