Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281220_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using FAM13A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

Rabbit FAM13A Polyclonal Antibody | anti-FAM13A antibody

FAM13A Polyclonal Antibody

Gene Names
FAM13A; FAM13A1; ARHGAP48
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
FAM13A, Antibody; FAM13A Polyclonal Antibody; ARHGAP48; FAM13A1; anti-FAM13A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MGAGALAICQSKAAVRLKEDMKKIVAVPLNEQKDFTYQKLFGVSLQELERQGLTENGIPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNC
Sequence Length
697
Applicable Applications for anti-FAM13A antibody
WB (Western Blot)
Immunogen
Recombinant funsion protein containing a sequence corresponding to amino acids 1-200 of human FAM13A (NP_055698.2)
Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
Jurkat, HeLa, Mouse pancreas
Calculated
77kDa; 78kDa; 80kDa; 116kDa
Observed
117kDa
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using FAM13A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281220_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using FAM13A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Product Categories/Family for anti-FAM13A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
protein FAM13A isoform b
NCBI Official Synonym Full Names
family with sequence similarity 13 member A
NCBI Official Symbol
FAM13A
NCBI Official Synonym Symbols
FAM13A1; ARHGAP48
NCBI Protein Information
protein FAM13A
UniProt Protein Name
Protein FAM13A
UniProt Gene Name
FAM13A
UniProt Synonym Gene Names
FAM13A1; KIAA0914

Similar Products

Product Notes

The FAM13A fam13a (Catalog #AAA281220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM13A Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAM13A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FAM13A fam13a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGAGALAICQ SKAAVRLKED MKKIVAVPLN EQKDFTYQKL FGVSLQELER QGLTENGIPA VVWNIVEYLT QHGLTQEGLF RVNGNVKVVE QLRLKFESGV PVELGKDGDV CSAASLLKLF LRELPDSLIT SALQPRFIQL FQDGRNDVQE SSLRDLIKEL PDTHYCLLKY LCQFLTKVAK HHVQNRMNVH NLATVFGPNC. It is sometimes possible for the material contained within the vial of "FAM13A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.