Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162784_IHC13.jpg IHC (Immunohiostchemistry) (FAM20A Antibody-Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit FAM20A Polyclonal Antibody | anti-FAM20A antibody

FAM20A Rabbit anti-Human Polyclonal Antibody

Average rating 0.0
No ratings yet
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
FAM20A, Antibody; FAM20A Rabbit anti-Human Polyclonal Antibody; IHC-plus FAM20A Antibody; FAM20A; AIGFS; FP2747; Protein FAM20A; anti-FAM20A antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human FAM20A
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Concentration
1mg/ml (varies by lot)
Applicable Applications for anti-FAM20A antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human FAM20A
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 140-240 of human FAM20A (NP_060035.2). YREQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACDCTQIVKPSGVHLKLVLRFSDFGKAMFKPMR
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohiostchemistry)

(FAM20A Antibody-Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA162784_IHC13.jpg IHC (Immunohiostchemistry) (FAM20A Antibody-Human Testis: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(FAM20A Antibody-Western blot blot of extracts of various cells, using FAM20A antibody at 1:1000)

product-image-AAA162784_WB15.jpg WB (Western Blot) (FAM20A Antibody-Western blot blot of extracts of various cells, using FAM20A antibody at 1:1000)
Related Product Information for anti-FAM20A antibody
FAM20A antibody is an unconjugated rabbit polyclonal antibody to FAM20A from human. It is reactive with human, mouse and rat. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
UniProt Protein Name
Protein FAM20A
UniProt Gene Name
FAM20A
UniProt Entry Name
FA20A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FAM20A fam20a (Catalog #AAA162784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM20A Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's FAM20A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FAM20A fam20a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FAM20A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.