WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and Fatty Acid Synthase (FASN) Rabbit pAb knockout (KO) HeLa cells, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
Rabbit anti-Human, Rat Fatty Acid Synthase (FASN) Polyclonal Antibody | anti-FASN antibody
[KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb
Gene Names
FASN; FAS; OA-519; SDR27X1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Fatty Acid Synthase (FASN), Antibody; [KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb; FAS; OA-519; SDR27X1; anti-FASN antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
Applicable Applications for anti-FASN antibody
WB (Western Blot)
Positive Samples
HeLa, MCF7, 293T, Rat liver
Cellular Location
Cytoplasm, Melanosome
Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cancer, Tumor biomarkers, Signal Transduction, Endocrine Metabolism, Lipid Metabolism, AMPK Signaling Pathway, Neuroscience, Cardiovascular, Lipids, Fatty Acids
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2221-2511 of human Fatty Acid Synthase (FASN)(NP_004095.4).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack
Ship: Ice Pack
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and Fatty Acid Synthase (FASN) Rabbit pAb knockout (KO) HeLa cells, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and Fatty Acid Synthase (FASN) Rabbit pAb knockout (KO) HeLa cells, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
WB (Western Blot)
(Western blot analysis of Rat liver, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
WB (Western Blot)
(Western blot analysis of Rat liver, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
WB (Western Blot)
(Western blot analysis of various lysates, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
WB (Western Blot)
(Western blot analysis of various lysates, using Fatty Acid Synthase (FASN) Rabbit pAb antibody (AAA282385) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 0.5s.)
Related Product Information for anti-FASN antibody
The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Product Categories/Family for anti-FASN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
273,427 Da
NCBI Official Full Name
fatty acid synthase
NCBI Official Synonym Full Names
fatty acid synthase
NCBI Official Symbol
FASN
NCBI Official Synonym Symbols
FAS; OA-519; SDR27X1
NCBI Protein Information
fatty acid synthase; short chain dehydrogenase/reductase family 27X, member 1
UniProt Protein Name
Fatty acid synthase
UniProt Gene Name
FASN
UniProt Synonym Gene Names
FAS
UniProt Entry Name
FAS_HUMAN
Similar Products
Product Notes
The FASN fasn (Catalog #AAA282385) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Fatty Acid Synthase (FASN) Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fatty Acid Synthase (FASN) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FASN fasn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SLLVNPEGPT LMRLNSVQSS ERPLFLVHPI EGSTTVFHSL ASRLSIPTYG LQCTRAAPLD SIHSLAAYYI DCIRQVQPEG PYRVAGYSYG ACVAFEMCSQ LQAQQSPAPT HNSLFLFDGS PTYVLAYTQS YRAKLTPGCE AEAETEAICF FVQQFTDMEH NRVLEALLPL KGLEERVAAA VDLIIKSHQG LDRQELSFAA RSFYYKLRAA EQYTPKAKYH GNVMLLRAKT GGAYGEDLGA DYNLSQVCDG KVSVHVIEGD HRTLLEGSGL ESIISIIHSS LAEPRVSVRE G. It is sometimes possible for the material contained within the vial of "Fatty Acid Synthase (FASN), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.