<
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug FBL antibody. Western blot was performed from the immunoprecipitate using FBL antibody at a dilition of 1:1000.)
Rabbit FBL Polyclonal Antibody | anti-FBL antibody
FBL Polyclonal Antibody
Gene Names
FBL; FIB; FLRN; Nop1; RNU3IP1
Reactivity
Human, Mouse, Rat, Monkey
Applications
Immunoprecipitation, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
FBL, Antibody; FBL Polyclonal Antibody; FIB; FLRN; Nop1; RNU3IP1; anti-FBL antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Monkey
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
RGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN
Sequence Length
321
Applicable Applications for anti-FBL antibody
IP (Immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human FBL
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug FBL antibody. Western blot was performed from the immunoprecipitate using FBL antibody at a dilition of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of HeLa cells using 1ug FBL antibody. Western blot was performed from the immunoprecipitate using FBL antibody at a dilition of 1:1000.)
IF (Immunofluorescence)
(Immunofluorescence analysis of A549 cells using FBL antibody. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of A549 cells using FBL antibody. Blue: DAPI for nuclear staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded mouse liver using FBL antibody at dilution of 1:100 (40x lens).)
IHC (Immunohiostchemistry)
(Immunohistochemistry of paraffin-embedded mouse liver using FBL antibody at dilution of 1:100 (40x lens).)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using FBL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
WB (Western Blot)
(Western blot analysis of extracts of various cell lines, using FBL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-FBL antibody
This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Product Categories/Family for anti-FBL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 33kDa
Observed: 37kDa
Observed: 37kDa
NCBI Official Full Name
rRNA 2'-O-methyltransferase fibrillarin
NCBI Official Synonym Full Names
fibrillarin
NCBI Official Symbol
FBL
NCBI Official Synonym Symbols
FIB; FLRN; Nop1; RNU3IP1
NCBI Protein Information
rRNA 2'-O-methyltransferase fibrillarin
UniProt Protein Name
rRNA 2'-O-methyltransferase fibrillarin
UniProt Gene Name
FBL
UniProt Synonym Gene Names
FIB1; FLRN
Similar Products
Product Notes
The FBL fbl (Catalog #AAA281077) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBL Polyclonal Antibody reacts with Human, Mouse, Rat, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's FBL can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FBL fbl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RGKEDALVTK NLVPGESVYG EKRVSISEGD DKIEYRAWNP FRSKLAAAIL GGVDQIHIKP GAKVLYLGAA SGTTVSHVSD IVGPDGLVYA VEFSHRSGRD LINLAKKRTN IIPVIEDARH PHKYRMLIAM VDVIFADVAQ PDQTRIVALN AHTFLRNGGH FVISIKANCI DSTASAEAVF ASEVKKMQQE NMKPQEQLTL EPYERDHAVV VGVYRPPPKV KN. It is sometimes possible for the material contained within the vial of "FBL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.