Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199226_WB8.jpg WB (Western Blot) (WB Suggested Anti-FBXO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)

Rabbit FBXO3 Polyclonal Antibody | anti-FBXO3 antibody

FBXO3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FBXO3; FBA; FBX3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXO3, Antibody; FBXO3 antibody - N-terminal region; anti-FBXO3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
Sequence Length
415
Applicable Applications for anti-FBXO3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FBXO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)

product-image-AAA199226_WB8.jpg WB (Western Blot) (WB Suggested Anti-FBXO3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Small Intestine)

WB (Western Blot)

(Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA199226_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: SERPINA3Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199226_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NSUN6Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199226_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GNASSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199226_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FAM46CSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FBXO3 antibody
This is a rabbit polyclonal antibody against FBXO3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end.
Product Categories/Family for anti-FBXO3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
F-box only protein 3 isoform 2
NCBI Official Synonym Full Names
F-box protein 3
NCBI Official Symbol
FBXO3
NCBI Official Synonym Symbols
FBA; FBX3
NCBI Protein Information
F-box only protein 3
UniProt Protein Name
F-box only protein 3
UniProt Gene Name
FBXO3
UniProt Synonym Gene Names
FBX3
UniProt Entry Name
FBX3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FBXO3 fbxo3 (Catalog #AAA199226) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FBXO3 fbxo3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NCCYVSRRLS QLSSHDPLWR RHCKKYWLIS EEEKTQKNQC WKSLFIDTYS. It is sometimes possible for the material contained within the vial of "FBXO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.