Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283309_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human FBXO32 Polyclonal Antibody | anti-FBXO32 antibody

FBXO32 Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
FBXO32, Antibody; FBXO32 Rabbit pAb; Fbx32; MAFbx; anti-FBXO32 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Sequence
ETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
Applicable Applications for anti-FBXO32 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 201-300 of human FBXO32 (NP_478136.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283309_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-431 cells using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283309_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-431 cells using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Rat leg bone tissue using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

product-image-AAA283309_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Rat leg bone tissue using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Mouse leg bone tissue using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

product-image-AAA283309_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Mouse leg bone tissue using FBXO32 Rabbit pAb (AAA283309) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)
Related Product Information for anti-FBXO32 antibody
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 42kDa
UniProt Protein Name
F-box only protein 32
UniProt Gene Name
FBXO32
UniProt Synonym Gene Names
MAFbx
UniProt Entry Name
FBX32_HUMAN

Similar Products

Product Notes

The FBXO32 fbxo32 (Catalog #AAA283309) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXO32 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO32 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the FBXO32 fbxo32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ETILHWQQQL NNIQITRPAF KGLTFTDLPL CLQLNIMQRL SDGRDLVSLG QAAPDLHVLS EDRLLWKKLC QYHFSERQIR KRLILSDKGQ LDWKKMYFKL. It is sometimes possible for the material contained within the vial of "FBXO32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.