Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199224_WB8.jpg WB (Western Blot) (WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateFBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit FBXW2 Polyclonal Antibody | anti-FBXW2 antibody

FBXW2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
FBXW2; Md6; FBW2; Fwd2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBXW2, Antibody; FBXW2 antibody - middle region; anti-FBXW2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI
Sequence Length
454
Applicable Applications for anti-FBXW2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FBXW2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateFBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA199224_WB8.jpg WB (Western Blot) (WB Suggested Anti-FBXW2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateFBXW2 is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199224_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199224_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199224_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FBXW2Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA199224_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FBXW2 antibody
This is a rabbit polyclonal antibody against FBXW2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. FBXW2 is the second identified member of the F-box family and contains multiple WD-40 repeats.F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-40 repeats.
Product Categories/Family for anti-FBXW2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
F-box/WD repeat-containing protein 2
NCBI Official Synonym Full Names
F-box and WD repeat domain containing 2
NCBI Official Symbol
FBXW2
NCBI Official Synonym Symbols
Md6; FBW2; Fwd2
NCBI Protein Information
F-box/WD repeat-containing protein 2
UniProt Protein Name
F-box/WD repeat-containing protein 2
UniProt Gene Name
FBXW2
UniProt Synonym Gene Names
FBW2; FWD2
UniProt Entry Name
FBXW2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FBXW2 fbxw2 (Catalog #AAA199224) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBXW2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FBXW2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FBXW2 fbxw2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLISRWPLPE YRKSKRGSSF LAGEASWLNG LDGHNDTGLV FATSMPDHSI. It is sometimes possible for the material contained within the vial of "FBXW2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.