Rabbit FCGR2C Polyclonal Antibody | anti-FCGR2C antibody
FCGR2C Antibody - N-terminal region
Gene Names
FCGR2C; CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FCGR2C, Antibody; FCGR2C Antibody - N-terminal region; anti-FCGR2C antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSD
Sequence Length
323
Applicable Applications for anti-FCGR2C antibody
WB (Western Blot)
Homology
Cow: 90%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Rabbit: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FCGR2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-FCGR2C antibody
This is a rabbit polyclonal antibody against FCGR2C. It was validated on Western Blot
Target Description: This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
Target Description: This gene encodes one of three members of a family of low-affinity immunoglobulin gamma Fc receptors found on the surface of many immune response cells. The encoded protein is a transmembrane glycoprotein and may be involved in phagocytosis and clearing of immune complexes. An allelic polymorphism in this gene results in both coding and non-coding variants.
Product Categories/Family for anti-FCGR2C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
low affinity immunoglobulin gamma Fc region receptor II-c
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIc (gene/pseudogene)
NCBI Official Symbol
FCGR2C
NCBI Official Synonym Symbols
CD32; FCG2; CD32C; CDW32; IGFR2; FCRIIC
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor II-c
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor II-c
UniProt Gene Name
FCGR2C
UniProt Synonym Gene Names
CD32; FCG2; IGFR2; IgG Fc receptor II-c; Fc-gamma-RIIc; FcRII-c
UniProt Entry Name
FCG2C_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The FCGR2C fcgr2c (Catalog #AAA201388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCGR2C Antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FCGR2C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FCGR2C fcgr2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTHSPESDSI PWFHNGNLIP THTQPSYRFK ANNNDSGEYT CQTGQTSLSD. It is sometimes possible for the material contained within the vial of "FCGR2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
