WB (Western Blot)
(WB Suggested Anti-FCGRT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateFCGRT is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit FCGRT Polyclonal Antibody | anti-FCGRT antibody
FCGRT antibody - N-terminal region
Gene Names
FCGRT; FCRN; alpha-chain
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FCGRT, Antibody; FCGRT antibody - N-terminal region; anti-FCGRT antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and may contain up to 2% sucrose.
Sequence
Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
Sequence Length
365
Applicable Applications for anti-FCGRT antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FCGRT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateFCGRT is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Anti-FCGRT Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateFCGRT is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(Host: RabbitTarget Name: FUSSample Type: Human 293T cell lysateAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: FUSSample Type: Human 293T cell lysateAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-FCGRT AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-FCGRT AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Membrane and cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FCGRT antibody
This is a rabbit polyclonal antibody against FCGRT. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.
Target Description: FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.
Product Categories/Family for anti-FCGRT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
IgG receptor FcRn large subunit p51
NCBI Official Synonym Full Names
Fc fragment of IgG receptor and transporter
NCBI Official Symbol
FCGRT
NCBI Official Synonym Symbols
FCRN; alpha-chain
NCBI Protein Information
IgG receptor FcRn large subunit p51
UniProt Protein Name
IgG receptor FcRn large subunit p51
UniProt Gene Name
FCGRT
UniProt Synonym Gene Names
FCRN; FcRn
UniProt Entry Name
FCGRN_HUMAN
Similar Products
Product Notes
The FCGRT fcgrt (Catalog #AAA199700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FCGRT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's FCGRT can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FCGRT fcgrt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GWLGPQQYLS YNSLRGEAEP CGAWVWENQV SWYWEKETTD LRIKEKLFLE. It is sometimes possible for the material contained within the vial of "FCGRT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.