Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23526_WB8.jpg WB (Western Blot) (WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate.MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit FER1L3 Polyclonal Antibody | anti-MYOF antibody

FER1L3 antibody - C-terminal region

Gene Names
MYOF; FER1L3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FER1L3, Antibody; FER1L3 antibody - C-terminal region; anti-MYOF antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTEFRIPPRLIIQIWDNDKFSLDDYLGFLELDLRHTIIPAKSPEKCRLDM
Sequence Length
2061
Applicable Applications for anti-MYOF antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FER1L3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate.MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23526_WB8.jpg WB (Western Blot) (WB Suggested Anti-FER1L3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate.MYOF is strongly supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA23526_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23526_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23526_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23526_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: HelaAntibody Dilution: 1.0ug/mlMYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23526_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: HelaAntibody Dilution: 1.0ug/mlMYOF is strongly supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: MYOFSample Type: 721_BAntibody Dilution: 1.0ug/mlMYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA23526_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: MYOFSample Type: 721_BAntibody Dilution: 1.0ug/mlMYOF is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

WB (Western Blot)

(Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23526_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: CHADSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYOF antibody
This is a rabbit polyclonal antibody against FER1L3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. FER1L3 is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Mutations in dysferlin, a protein associated with the plasma membrane, can cause muscle weakness that affects both proximal and distal muscles. The protein encoded by this gene is a type II membrane protein that is structurally similar to dysferlin. It is a member of the ferlin family and associates with both plasma and nuclear membranes. The protein contains C2 domains that play a role in calcium-mediated membrane fusion events, suggesting that it may be involved in membrane regeneration and repair. Two transcript variants encoding different isoforms have been found for this gene. Other possible variants have been detected, but their full-length natures have not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
235kDa
NCBI Official Full Name
myoferlin isoform a
NCBI Official Synonym Full Names
myoferlin
NCBI Official Symbol
MYOF
NCBI Official Synonym Symbols
FER1L3
NCBI Protein Information
myoferlin
UniProt Protein Name
Myoferlin
UniProt Gene Name
MYOF
UniProt Synonym Gene Names
FER1L3; KIAA1207
UniProt Entry Name
MYOF_HUMAN

Similar Products

Product Notes

The MYOF myof (Catalog #AAA23526) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FER1L3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FER1L3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MYOF myof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTEFRIPPRL IIQIWDNDKF SLDDYLGFLE LDLRHTIIPA KSPEKCRLDM. It is sometimes possible for the material contained within the vial of "FER1L3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.