Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200086_WB8.jpg WB (Western Blot) (WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

Rabbit FEZF1 Polyclonal Antibody | anti-FEZF1 antibody

FEZF1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
FEZF1; FEZ; HH22; ZNF312B
Reactivity
Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FEZF1, Antibody; FEZF1 antibody - C-terminal region; anti-FEZF1 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPTCGKGFCRNFDLKKHVRKLHDSSLGLARTPAGEPGTEPPPPLPQQPPM
Sequence Length
471
Applicable Applications for anti-FEZF1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Guinea Pig: 79%; Horse: 79%; Human: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FEZF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

product-image-AAA200086_WB8.jpg WB (Western Blot) (WB Suggested Anti-FEZF1 Antibody Titration: 1 ug/mlPositive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: FEZF1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA200086_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: FEZF1Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemisry)

(Human Placenta)

product-image-AAA200086_IHC11.jpg IHC (Immunohistochemisry) (Human Placenta)

IHC (Immunohiostchemistry)

(Human Pancreas)

product-image-AAA200086_IHC13.jpg IHC (Immunohiostchemistry) (Human Pancreas)

IHC (Immunohistochemistry)

(Human Pancreas)

product-image-AAA200086_IHC15.jpg IHC (Immunohistochemistry) (Human Pancreas)
Related Product Information for anti-FEZF1 antibody
This is a rabbit polyclonal antibody against FEZF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FEZF1 is a transcription repressor. It is involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). It plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression of the FEZF1 is required in OSN to cell-autonomously regulate OSN axon projections. FEZF1 regulates non-cell-autonomously the layer formation of the olfactory bulb development and the interneurons. It may be required for correct rostral migration of the interneuron progenitors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
fez family zinc finger protein 1 isoform 1
NCBI Official Synonym Full Names
FEZ family zinc finger 1
NCBI Official Symbol
FEZF1
NCBI Official Synonym Symbols
FEZ; HH22; ZNF312B
NCBI Protein Information
fez family zinc finger protein 1
UniProt Protein Name
Fez family zinc finger protein 1
UniProt Gene Name
FEZF1
UniProt Synonym Gene Names
FEZ; ZNF312B
UniProt Entry Name
FEZF1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FEZF1 fezf1 (Catalog #AAA200086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FEZF1 antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FEZF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FEZF1 fezf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPTCGKGFCR NFDLKKHVRK LHDSSLGLAR TPAGEPGTEP PPPLPQQPPM. It is sometimes possible for the material contained within the vial of "FEZF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.