Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201322_WB13.jpg WB (Western Blot) (WB Host: RabbitTarget: FFAR2Positive control (+): Human liver (LI)Negative control (-): 293T (2T)Antibody concentration: 1ug/ml)

Rabbit FFAR2 Polyclonal Antibody | anti-FFAR2 antibody

FFAR2 antibody - C-terminal region

Gene Names
FFAR2; FFA2R; GPR43
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FFAR2, Antibody; FFAR2 antibody - C-terminal region; anti-FFAR2 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Sequence Length
330
Applicable Applications for anti-FFAR2 antibody
WB (Western Blot)
Homology
Dog: 85%; Human: 100%
Protein Size (#AA)
330 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Host: RabbitTarget: FFAR2Positive control (+): Human liver (LI)Negative control (-): 293T (2T)Antibody concentration: 1ug/ml)

product-image-AAA201322_WB13.jpg WB (Western Blot) (WB Host: RabbitTarget: FFAR2Positive control (+): Human liver (LI)Negative control (-): 293T (2T)Antibody concentration: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FFAR2Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA201322_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FFAR2Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FFAR2 antibody
This is a rabbit polyclonal antibody against FFAR2. It was validated on Western Blot

Target Description: This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels.
Product Categories/Family for anti-FFAR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
free fatty acid receptor 2
NCBI Official Synonym Full Names
free fatty acid receptor 2
NCBI Official Symbol
FFAR2
NCBI Official Synonym Symbols
FFA2R; GPR43
NCBI Protein Information
free fatty acid receptor 2
UniProt Protein Name
Free fatty acid receptor 2
UniProt Gene Name
FFAR2
UniProt Synonym Gene Names
GPR43
UniProt Entry Name
FFAR2_HUMAN

Similar Products

Product Notes

The FFAR2 ffar2 (Catalog #AAA201322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FFAR2 antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's FFAR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FFAR2 ffar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRAFGRGLQV LRNQGSSLLG RRGKDTAEGT NEDRGVGQGE GMPSSDFTTE. It is sometimes possible for the material contained within the vial of "FFAR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.