Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197209_WB11.jpg WB (Western Blot) (WB Suggested Anti-FGD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Raji cell lysateFGD1 is supported by BioGPS gene expression data to be expressed in Raji)

Rabbit FGD1 Polyclonal Antibody | anti-FGD1 antibody

FGD1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
FGD1; AAS; FGDY; MRXS16; ZFYVE3
Reactivity
Tested: Human
Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FGD1, Antibody; FGD1 antibody - C-terminal region; anti-FGD1 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
Sequence Length
961
Applicable Applications for anti-FGD1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FGD1
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FGD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Raji cell lysateFGD1 is supported by BioGPS gene expression data to be expressed in Raji)

product-image-AAA197209_WB11.jpg WB (Western Blot) (WB Suggested Anti-FGD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Raji cell lysateFGD1 is supported by BioGPS gene expression data to be expressed in Raji)

IHC (Immunohiostchemistry)

(Rabbit Anti-FGD1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA197209_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-FGD1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human TestisPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

IHC (Immunohistochemistry)

(Rabbit Anti-FGD1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197209_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-FGD1 AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-FGD1 antibody
This is a rabbit polyclonal antibody against FGD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
Product Categories/Family for anti-FGD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
107kDa
NCBI Official Full Name
FYVE, RhoGEF and PH domain-containing protein 1
NCBI Official Synonym Full Names
FYVE, RhoGEF and PH domain containing 1
NCBI Official Symbol
FGD1
NCBI Official Synonym Symbols
AAS; FGDY; MRXS16; ZFYVE3
NCBI Protein Information
FYVE, RhoGEF and PH domain-containing protein 1
UniProt Protein Name
FYVE, RhoGEF and PH domain-containing protein 1
UniProt Gene Name
FGD1
UniProt Synonym Gene Names
FGDY; ZFYVE3; Rho/Rac GEF
UniProt Entry Name
FGD1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGD1 fgd1 (Catalog #AAA197209) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGD1 antibody - C-terminal region reacts with Tested: Human Predicted: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FGD1 fgd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WMAVLGRAGR GDTFCPGPTL SEDREMEEAP VAALGATAEP PESPQTRDKT. It is sometimes possible for the material contained within the vial of "FGD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.