WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and FGF2 Rabbit pAb knockout (KO) HeLa cells, using FGF2 Rabbit pAb antibody (AAA282386) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
Rabbit FGF2 Polyclonal Antibody | anti-FGF2 antibody
[KO Validated] FGF2 Rabbit pAb
Gene Names
FGF2; BFGF; FGFB; FGF-2; HBGF-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
FGF2, Antibody; [KO Validated] FGF2 Rabbit pAb; BFGF; FGFB; FGF-2; HBGF-2; anti-FGF2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Applicable Applications for anti-FGF2 antibody
WB (Western Blot)
Positive Samples
HeLa, Mouse ovary
Cellular Location
Nucleus, Secreted
Research Area
Cancer, Invasion and Metastasis, Signal Transduction, Cell Biology Developmental Biology, Growth factors, Neuroscience, Stem Cells, Neural Stem Cells, Cardiovascular, Angiogenesis
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack
Ship: Ice Pack
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and FGF2 Rabbit pAb knockout (KO) HeLa cells, using FGF2 Rabbit pAb antibody (AAA282386) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of extracts from wild type(WT) and FGF2 Rabbit pAb knockout (KO) HeLa cells, using FGF2 Rabbit pAb antibody (AAA282386) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of Mouse ovary, using FGF2 Rabbit pAb antibody (AAA282386) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of Mouse ovary, using FGF2 Rabbit pAb antibody (AAA282386) at 1:2000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
Related Product Information for anti-FGF2 antibody
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF.
Product Categories/Family for anti-FGF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
30,770 Da
NCBI Official Full Name
basic fibroblast growth factor, partial
NCBI Official Synonym Full Names
fibroblast growth factor 2 (basic)
NCBI Official Symbol
FGF2
NCBI Official Synonym Symbols
BFGF; FGFB; FGF-2; HBGF-2
NCBI Protein Information
fibroblast growth factor 2; prostatropin; heparin-binding growth factor 2; basic fibroblast growth factor bFGF
UniProt Protein Name
Fibroblast growth factor 2
UniProt Gene Name
FGF2
UniProt Synonym Gene Names
FGFB; FGF-2; bFGF; HBGF-2
UniProt Entry Name
FGF2_HUMAN
Similar Products
Product Notes
The FGF2 fgf2 (Catalog #AAA282386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] FGF2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGF2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FGF2 fgf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RAPERVGGRG RGRGTAAPRA APAARGSRPG PAGTMAAGSI TTLPALPEDG GSGAFPPGHF KDPKRLYCKN GGFFLRIHPD GRVDGVREKS DPHIKLQLQA E. It is sometimes possible for the material contained within the vial of "FGF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.