Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23563_APP5.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

Rabbit FGF21 Polyclonal Antibody | anti-FGF21 antibody

FGF21 antibody - N-terminal region

Average rating 0.0
No ratings yet
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FGF21, Antibody; FGF21 antibody - N-terminal region; anti-FGF21 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT
Sequence Length
209
Applicable Applications for anti-FGF21 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Predicted Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FGF21
Protein Size (# AA)
209 amino acids
Protein Interactions
MAPK7; CDH7; CDC25A; ELAVL1; Nedd4; KLB;
Blocking Peptide
For anti-FGF21 (AAA23563) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Application Data

(Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

product-image-AAA23563_APP5.jpg Application Data (Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.)

WB (Western Blot)

(Host: RabbitTarget Name: FGF21Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

product-image-AAA23563_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: FGF21Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FGF21Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23563_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: FGF21Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FGF21Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 3ug/ml)

product-image-AAA23563_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: FGF21Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 3ug/ml)

IHC (Immunohistochemistry)

(Human Liver)

product-image-AAA23563_IHC.jpg IHC (Immunohistochemistry) (Human Liver)
Related Product Information for anti-FGF21 antibody
FGF21 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
fibroblast growth factor 21
NCBI Official Synonym Full Names
fibroblast growth factor 21
NCBI Official Symbol
FGF21
NCBI Protein Information
fibroblast growth factor 21
UniProt Protein Name
Fibroblast growth factor 21
UniProt Gene Name
FGF21
UniProt Synonym Gene Names
FGF-21
UniProt Entry Name
FGF21_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGF21 fgf21 (Catalog #AAA23563) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGF21 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FGF21 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml. Researchers should empirically determine the suitability of the FGF21 fgf21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSDETGFEHS GLWVSVLAGL LLGACQAHPI PDSSPLLQFG GQVRQRYLYT. It is sometimes possible for the material contained within the vial of "FGF21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.