WB (Western Blot)
(WB Suggested Anti-FGFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateFGFR2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Rabbit FGFR2 Polyclonal Antibody | anti-FGFR2 antibody
FGFR2 antibody - C-terminal region
Gene Names
FGFR2; BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FGFR2, Antibody; FGFR2 antibody - C-terminal region; anti-FGFR2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ
Sequence Length
705
Applicable Applications for anti-FGFR2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FGFR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FGFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateFGFR2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
WB (Western Blot)
(WB Suggested Anti-FGFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysateFGFR2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
WB (Western Blot)
(Host: MouseTarget Name: FGFR2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: FGFR2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Sample Type: r-FGFR2Sample Type: HEK293 (20ug)Primary Dilution:1:200Secondary Dilution:1:5000Image Submitted by: Anonymous→See Customer Feedback section for detailed Information )
WB (Western Blot)
(Sample Type: r-FGFR2Sample Type: HEK293 (20ug)Primary Dilution:1:200Secondary Dilution:1:5000Image Submitted by: Anonymous→See Customer Feedback section for detailed Information )
Related Product Information for anti-FGFR2 antibody
This is a rabbit polyclonal antibody against FGFR2. It was validated on Western Blot
Target Description: The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Target Description: The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product Categories/Family for anti-FGFR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
fibroblast growth factor receptor 2 isoform 2
NCBI Official Synonym Full Names
fibroblast growth factor receptor 2
NCBI Official Symbol
FGFR2
NCBI Official Synonym Symbols
BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM
NCBI Protein Information
fibroblast growth factor receptor 2
UniProt Protein Name
Fibroblast growth factor receptor 2
UniProt Gene Name
FGFR2
UniProt Synonym Gene Names
BEK; KGFR; KSAM; FGFR-2; KGFR
UniProt Entry Name
FGFR2_HUMAN
Similar Products
Product Notes
The FGFR2 fgfr2 (Catalog #AAA200985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGFR2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FGFR2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FGFR2 fgfr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPKEAVTVAV KMLKDDATEK DLSDLVSEME MMKMIGKHKN IINLLGACTQ. It is sometimes possible for the material contained within the vial of "FGFR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.