Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199422_WB11.jpg WB (Western Blot) (WB Suggested Anti-FGG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

Rabbit FGG Polyclonal Antibody | anti-FGG antibody

FGG antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FGG, Antibody; FGG antibody - middle region; anti-FGG antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQ
Sequence Length
437
Applicable Applications for anti-FGG antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FGG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FGG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

product-image-AAA199422_WB11.jpg WB (Western Blot) (WB Suggested Anti-FGG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: FGGSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA199422_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FGGSample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Placenta tissue)

product-image-AAA199422_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Placenta tissue)
Related Product Information for anti-FGG antibody
This is a rabbit polyclonal antibody against FGG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
fibrinogen gamma chain isoform gamma-A
NCBI Official Synonym Full Names
fibrinogen gamma chain
NCBI Official Symbol
FGG
NCBI Protein Information
fibrinogen gamma chain
UniProt Protein Name
Fibrinogen gamma chain
UniProt Gene Name
FGG
UniProt Entry Name
FIBG_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FGG fgg (Catalog #AAA199422) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FGG antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FGG can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FGG fgg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GWTVFQKRLD GSVDFKKNWI QYKEGFGHLS PTGTTEFWLG NEKIHLISTQ. It is sometimes possible for the material contained within the vial of "FGG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.