Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281652_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using FKBP1B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit FKBP1B Polyclonal Antibody | anti-FKBP1B antibody

FKBP1B Rabbit pAb

Gene Names
FKBP1B; OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
FKBP1B, Antibody; FKBP1B Rabbit pAb; FKBP1B; FKBP12.6; FKBP1L; OTK4; PKBP1L; PPIase; anti-FKBP1B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQLGPLSPLPICPHPC
Applicable Applications for anti-FKBP1B antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-80 of human FKBP1B (NP_473374.1).
Cellular Location
Cytoplasm, Sarcoplasmic reticulum
Positive Samples
22Rv1, Mouse brain, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using FKBP1B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281652_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using FKBP1B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using FKBP1B antibody at dilution of 1:100 (40x lens).)

product-image-AAA281652_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using FKBP1B antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spinal cord using FKBP1B antibody at dilution of 1:100 (40x lens).)

product-image-AAA281652_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spinal cord using FKBP1B antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat heart using FKBP1B antibody at dilution of 1:100 (40x lens).)

product-image-AAA281652_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat heart using FKBP1B antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using FKBP1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281652_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using FKBP1B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-FKBP1B antibody
Background: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is highly similar to the FK506-binding protein 1A. Its physiological role is thought to be in excitation-contraction coupling in cardiac muscle. There are two alternatively spliced transcript variants of this gene encoding different isoforms.
Product Categories/Family for anti-FKBP1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8,802 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1B isoform a
NCBI Official Synonym Full Names
FK506 binding protein 1B, 12.6 kDa
NCBI Official Symbol
FKBP1B
NCBI Official Synonym Symbols
OTK4; FKBP1L; PKBP1L; PPIase; FKBP12.6
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1B; 12.6 kDa FK506-binding protein; 12.6 kDa FKBP; FK506-binding protein 12.6; FK506-binding protein 1B; FKBP-12.6; FKBP-1B; PPIase FKBP1B; calstabin 2; h-FKBP-12; immunophilin FKBP12.6; rotamase
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1B
UniProt Gene Name
FKBP1B
UniProt Synonym Gene Names
FKBP12.6; FKBP1L; FKBP9; OTK4; PPIase FKBP1B; 12.6 kDa FKBP; FKBP-12.6; FKBP-1B
UniProt Entry Name
FKB1B_HUMAN

Similar Products

Product Notes

The FKBP1B fkbp1b (Catalog #AAA281652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP1B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP1B can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FKBP1B fkbp1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGVEIETISP GDGRTFPKKG QTCVVHYTGM LQNGKKFDSS RDRNKPFKFR IGKQEVIKGF EEGAAQLGPL SPLPICPHPC. It is sometimes possible for the material contained within the vial of "FKBP1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.