Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46430_WB15.jpg WB (Western Blot) (Anti- FMO1 Picoband antibody, AAA46430, Western blottingAll lanes: Anti FMO1 (AAA46430) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: Rat Kidney Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD)

FMO1 Polyclonal Antibody | anti-FMO1 antibody

Anti-FMO1 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FMO1, Antibody; Anti-FMO1 Antibody; Dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline monooxygenase [N oxide forming] 1; Dimethylaniline oxidase 1; Fetal hepatic flavin containing monooxygenase 1; Fetal hepatic flavin-containing monooxygenase 1; Flavin containing monooxygenase 1 (fetal liver); Flavin Containing Monooxygenase 1; FMO 1; FMO1; FMO1_HUMAN; OTTHUMP00000033536; OTTHUMP00000033537; flavin containing monooxygenase 1; anti-FMO1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
536
Applicable Applications for anti-FMO1 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- FMO1 Picoband antibody, AAA46430, Western blottingAll lanes: Anti FMO1 (AAA46430) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: Rat Kidney Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD)

product-image-AAA46430_WB15.jpg WB (Western Blot) (Anti- FMO1 Picoband antibody, AAA46430, Western blottingAll lanes: Anti FMO1 (AAA46430) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: Rat Kidney Tissue Lysate at 50ugLane 4: Mouse Kidney Tissue Lysate at 50ugLane 5: SMMC Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD)
Related Product Information for anti-FMO1 antibody
Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human;Mouse; Rat.

Background: Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: FMO1 flavin containing monooxygenase 1". 2. Cashman JR (2004). "The implications of polymorphisms in mammalian flavin-containing monooxygenases in drug discovery and development".Drug Discov. Today 9 (13): 574-581. 3. Dolphin C, Shephard EA, Povey S et al. (1991). "Cloning, primary sequence, and chromosomal mapping of a human flavin-containing monooxygenase (FMO1)".J. Biol. Chem. 266 (19): 12379-85.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
dimethylaniline monooxygenase
NCBI Official Synonym Full Names
flavin containing monooxygenase 1
NCBI Official Symbol
FMO1
NCBI Protein Information
dimethylaniline monooxygenase [N-oxide-forming] 1
UniProt Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 1
UniProt Gene Name
FMO1
UniProt Synonym Gene Names
FMO 1
UniProt Entry Name
FMO1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FMO1 fmo1 (Catalog #AAA46430) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FMO1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FMO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FMO1 fmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.