Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197388_WB11.jpg WB (Western Blot) (WB Suggested Anti-FOSB Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit FOSB Polyclonal Antibody | anti-FOSB antibody

FOSB antibody - C-terminal region

Gene Names
FOSB; AP-1; G0S3; GOS3; GOSB
Reactivity
Tested Reactivity: Human, Mouse
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
FOSB, Antibody; FOSB antibody - C-terminal region; anti-FOSB antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human, Mouse
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL
Applicable Applications for anti-FOSB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
338 amino acids
Protein Interactions
BAG3; SRA1; EP300; CREBBP; JUND; JUNB;
Blocking Peptide
For anti-FOSB (MBS3200989) antibody is Catalog # MBS3226019
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FOSB
Replacement Item
This antibody may replace item sc-177246 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 92%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOSB Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA197388_WB11.jpg WB (Western Blot) (WB Suggested Anti-FOSB Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

product-image-AAA197388_WB13.jpg WB (Western Blot)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA197388_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-FOSB antibody
This is a rabbit polyclonal antibody against FOSB. It was validated on Western Blot and immunohistochemistry

Target Description: The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
protein fosB isoform 1
NCBI Official Synonym Full Names
FosB proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
FOSB
NCBI Official Synonym Symbols
AP-1; G0S3; GOS3; GOSB
NCBI Protein Information
protein fosB
UniProt Protein Name
Protein fosB
UniProt Gene Name
FOSB
UniProt Synonym Gene Names
G0S3
UniProt Entry Name
FOSB_HUMAN

Similar Products

Product Notes

The FOSB fosb (Catalog #AAA197388) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOSB antibody - C-terminal region reacts with Tested Reactivity: Human, Mouse Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOSB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FOSB fosb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLPGSAPAKE DGFSWLLPPP PPPPLPFQTS QDAPPNLTAS LFTHSEVQVL. It is sometimes possible for the material contained within the vial of "FOSB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.