Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198416_WB13.jpg WB (Western Blot) (WB Suggested Anti-FOXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit FOXI1 Polyclonal Antibody | anti-FOXI1 antibody

FOXI1 antibody - N-terminal region

Gene Names
FOXI1; HFH3; FKH10; HFH-3; FKHL10; FREAC6; FREAC-6
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXI1, Antibody; FOXI1 antibody - N-terminal region; anti-FOXI1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFE
Sequence Length
378
Applicable Applications for anti-FOXI1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FOXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA198416_WB13.jpg WB (Western Blot) (WB Suggested Anti-FOXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Hum. Fetal Heart)

product-image-AAA198416_WB15.jpg WB (Western Blot) (Hum. Fetal Heart)
Related Product Information for anti-FOXI1 antibody
This is a rabbit polyclonal antibody against FOXI1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXI1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. FOXI1 may plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis.This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it is possible that this gene plays an important role in the development of the cochlea and vestibulum, as well as embryogenesis. Mutations in this gene may be associated with the common cavity phenotype. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
forkhead box protein I1 isoform a
NCBI Official Synonym Full Names
forkhead box I1
NCBI Official Symbol
FOXI1
NCBI Official Synonym Symbols
HFH3; FKH10; HFH-3; FKHL10; FREAC6; FREAC-6
NCBI Protein Information
forkhead box protein I1
UniProt Protein Name
Forkhead box protein I1
UniProt Gene Name
FOXI1
UniProt Synonym Gene Names
FKHL10; FREAC6; FREAC-6; HFH-3; HNF-3/fork-head homolog 3
UniProt Entry Name
FOXI1_HUMAN

Similar Products

Product Notes

The FOXI1 foxi1 (Catalog #AAA198416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXI1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXI1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FOXI1 foxi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSFDLPAPS PPRCSPQFPS IGQEPPEMNL YYENFFHPQG VPSPQRPSFE. It is sometimes possible for the material contained within the vial of "FOXI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.