<
SDS_PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
Rabbit FOXL1 Polyclonal Antibody | anti-FOXL1 antibody
FOXL1 antibody - N-terminal region
Gene Names
FOXL1; FKH6; FKHL11; FREAC7
Reactivity
Tested: Human, MousePredicted: Cow, Dog, Horse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
FOXL1, Antibody; FOXL1 antibody - N-terminal region; anti-FOXL1 antibody
Host
Rabbit
Reactivity
Tested: Human, Mouse
Predicted: Cow, Dog, Horse, Pig, Rabbit, Rat
Predicted: Cow, Dog, Horse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY
Sequence Length
345
Applicable Applications for anti-FOXL1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 92%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXL1
Protein Size (#AA)
345 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
SDS_PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
SDS_PAGE
(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)
WB (Western Blot)
(WB Suggested Anti-FOXL1 Antibody Titration: 2.5ug/mlPositive Control: Human Liver)
WB (Western Blot)
(WB Suggested Anti-FOXL1 Antibody Titration: 2.5ug/mlPositive Control: Human Liver)
WB (Western Blot)
(Host: MouseTarget Name: FOXL1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: FOXL1Sample Tissue: Mouse Skeletal MuscleAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Human Muscle)
IHC (Immunohistochemistry)
(Human Muscle)
Related Product Information for anti-FOXL1 antibody
This is a rabbit polyclonal antibody against FOXL1. It was validated on Western Blot and immunohistochemistry
Target Description: FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
Target Description: FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.
Product Categories/Family for anti-FOXL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
forkhead box protein L1
NCBI Official Synonym Full Names
forkhead box L1
NCBI Official Symbol
FOXL1
NCBI Official Synonym Symbols
FKH6; FKHL11; FREAC7
NCBI Protein Information
forkhead box protein L1
UniProt Protein Name
Forkhead box protein L1
UniProt Gene Name
FOXL1
UniProt Synonym Gene Names
FKHL11; FREAC7; FREAC-7
UniProt Entry Name
FOXL1_HUMAN
Similar Products
Product Notes
The FOXL1 foxl1 (Catalog #AAA197326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXL1 antibody - N-terminal region reacts with Tested: Human, Mouse Predicted: Cow, Dog, Horse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FOXL1 foxl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLFDPRLPAL AASPMLYLYG PERPGLPLAF APAAALAASG RAETPQKPPY. It is sometimes possible for the material contained within the vial of "FOXL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.