Rabbit FOXP1 Polyclonal Antibody | anti-FOXP1 antibody
FOXP1 antibody - N-terminal region
Gene Names
FOXP1; MFH; QRF1; 12CC4; hFKH1B; HSPC215
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
FOXP1, Antibody; FOXP1 antibody - N-terminal region; anti-FOXP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
Sequence Length
677
Applicable Applications for anti-FOXP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-FOXP1 antibody
This is a rabbit polyclonal antibody against FOXP1. It was validated on Western Blot and immunohistochemistry
Target Description: FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Target Description: FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
Product Categories/Family for anti-FOXP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
forkhead box protein P1 isoform a
NCBI Official Synonym Full Names
forkhead box P1
NCBI Official Symbol
FOXP1
NCBI Official Synonym Symbols
MFH; QRF1; 12CC4; hFKH1B; HSPC215
NCBI Protein Information
forkhead box protein P1
UniProt Protein Name
Forkhead box protein P1
UniProt Gene Name
FOXP1
UniProt Entry Name
FOXP1_HUMAN
Similar Products
Product Notes
The FOXP1 foxp1 (Catalog #AAA197402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FOXP1 foxp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MIPTELQQLW KEVTSAHTAE ETTGNNHSSL DLTTTCVSSS APSKTSLI. It is sometimes possible for the material contained within the vial of "FOXP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
