Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200269_WB11.jpg WB (Western Blot) (WB Suggested Anti-FSIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

Rabbit FSIP1 Polyclonal Antibody | anti-FSIP1 antibody

FSIP1 antibody - middle region

Gene Names
FSIP1; HSD10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FSIP1, Antibody; FSIP1 antibody - middle region; anti-FSIP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPT
Sequence Length
581
Applicable Applications for anti-FSIP1 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FSIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FSIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

product-image-AAA200269_WB11.jpg WB (Western Blot) (WB Suggested Anti-FSIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: FSIP1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200269_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: FSIP1Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: FSIP1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200269_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: FSIP1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-FSIP1 antibody
This is a rabbit polyclonal antibody against FSIP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact functions of FSIP1 remain unknown.
Product Categories/Family for anti-FSIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
fibrous sheath-interacting protein 1
NCBI Official Synonym Full Names
fibrous sheath interacting protein 1
NCBI Official Symbol
FSIP1
NCBI Official Synonym Symbols
HSD10
NCBI Protein Information
fibrous sheath-interacting protein 1
UniProt Protein Name
Fibrous sheath-interacting protein 1
UniProt Gene Name
FSIP1

Similar Products

Product Notes

The FSIP1 fsip1 (Catalog #AAA200269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FSIP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FSIP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FSIP1 fsip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEKDSGLSSS EGDQSGWVVP VKGYELAVTQ HQQLAEIDIK LQELSAASPT. It is sometimes possible for the material contained within the vial of "FSIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.