WB (Western Blot)
(WB Suggested Anti-FUBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFUBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Rabbit FUBP1 Polyclonal Antibody | anti-FUBP1 antibody
FUBP1 antibody - middle region
Gene Names
FUBP1; FBP; FUBP; hDH V
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
FUBP1, Antibody; FUBP1 antibody - middle region; anti-FUBP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEY
Sequence Length
644
Applicable Applications for anti-FUBP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FUBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-FUBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFUBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
WB (Western Blot)
(WB Suggested Anti-FUBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFUBP1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-FUBP1 antibody)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Breast tissue at an antibody concentration of 5.0ug/ml using anti-FUBP1 antibody)
Related Product Information for anti-FUBP1 antibody
This is a rabbit polyclonal antibody against FUBP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: FUBP1 is a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Target Description: FUBP1 is a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase.This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding strand. This protein has been shown to function as an ATP-dependent DNA helicase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-FUBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
far upstream element-binding protein 1 isoform 2
NCBI Official Synonym Full Names
far upstream element binding protein 1
NCBI Official Symbol
FUBP1
NCBI Official Synonym Symbols
FBP; FUBP; hDH V
NCBI Protein Information
far upstream element-binding protein 1
UniProt Protein Name
Far upstream element-binding protein 1
UniProt Gene Name
FUBP1
UniProt Synonym Gene Names
FBP; FUSE-binding protein 1; hDH V
UniProt Entry Name
FUBP1_HUMAN
Similar Products
Product Notes
The FUBP1 fubp1 (Catalog #AAA198010) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FUBP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FUBP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the FUBP1 fubp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YYAHYYQQQA QPPPAAPAGA PTTTQTNGQG DQQNPAPAGQ VDYTKAWEEY. It is sometimes possible for the material contained within the vial of "FUBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.