Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282336_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human tonsil using FXYD3 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit anti-Human FXYD3 Polyclonal Antibody | anti-FXYD3 antibody

FXYD3 Rabbit pAb

Gene Names
SETD3; C14orf154
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
FXYD3, Antibody; FXYD3 Rabbit pAb; MAT8; PLML; anti-FXYD3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVTFDGKREDYFPDLMKWASENGASVEGFEMVN
Applicable Applications for anti-FXYD3 antibody
WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human FXYD3 (NP_005962.1).
Cellular Location
extracellular exosome, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using FXYD3 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282336_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human tonsil using FXYD3 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon using FXYD3 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282336_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon using FXYD3 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-FXYD3 antibody
This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-FXYD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,540 Da
NCBI Official Full Name
histone-lysine N-methyltransferase setd3 isoform a
NCBI Official Synonym Full Names
SET domain containing 3
NCBI Official Symbol
SETD3
NCBI Official Synonym Symbols
C14orf154
NCBI Protein Information
histone-lysine N-methyltransferase setd3
UniProt Protein Name
Histone-lysine N-methyltransferase setd3
UniProt Gene Name
SETD3
UniProt Synonym Gene Names
C14orf154
UniProt Entry Name
SETD3_HUMAN

Similar Products

Product Notes

The FXYD3 setd3 (Catalog #AAA282336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FXYD3 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FXYD3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FXYD3 setd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGKKSRVKTQ KSGTGATATV SPKEILNLTS ELLQKCSSPA PGPGKEWEEY VQIRTLVEKI RKKQKGLSVT FDGKREDYFP DLMKWASENG ASVEGFEMVN. It is sometimes possible for the material contained within the vial of "FXYD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.