Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198854_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FZD10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Rabbit FZD10 Polyclonal Antibody | anti-FZD10 antibody

FZD10 Antibody

Average rating 0.0
No ratings yet
Gene Names
FZD10; Fz10; FzE7; CD350; FZ-10; hFz10
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Applications
Immunofluorescence
Purity
Affinity Purified
Synonyms
FZD10, Antibody; FZD10 Antibody; anti-FZD10 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Sequence Length
581
Applicable Applications for anti-FZD10 antibody
IF (Immunofluorescence)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence GMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKAQHPQKTHH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: FZD10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198854_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: FZD10Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

IF (Immunofluorescence)

(Sample Type: COS7 cells transfected with chick FZD10FZD10 AntibodySample type: COS7 cells transfected with chick FZD10Primary Ab dilution: 1:333Secondary Ab: anti-rabbit-Cy2Secondary Ab dilution: 1:500Blue: DAPIGreen:FZD10Data submitted by: Lisa Galli/Laura BurrusSan Francisco State University)

product-image-AAA198854_IF13.jpg IF (Immunofluorescence) (Sample Type: COS7 cells transfected with chick FZD10FZD10 AntibodySample type: COS7 cells transfected with chick FZD10Primary Ab dilution: 1:333Secondary Ab: anti-rabbit-Cy2Secondary Ab dilution: 1:500Blue: DAPIGreen:FZD10Data submitted by: Lisa Galli/Laura BurrusSan Francisco State University)

IF (Immunofluorescence)

(Sample Type: COS7 cells mock transfectedFZD10 AntibodySample type: COS7 cells mock transfectedPrimary Ab dilution: 1:333Secondary Ab: anti-rabbit-Cy2Secondary Ab dilution: 1:500Blue: DAPIGreen:FZD10Data submitted by: Lisa Galli/Laura BurrusSan Francisco State University)

product-image-AAA198854_IF15.jpg IF (Immunofluorescence) (Sample Type: COS7 cells mock transfectedFZD10 AntibodySample type: COS7 cells mock transfectedPrimary Ab dilution: 1:333Secondary Ab: anti-rabbit-Cy2Secondary Ab dilution: 1:500Blue: DAPIGreen:FZD10Data submitted by: Lisa Galli/Laura BurrusSan Francisco State University)
Related Product Information for anti-FZD10 antibody
frizzled family receptor 10

Target Description: This gene is a member of the frizzled gene family. Members of this family encode 7-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. Using array analysis, expression of this intronless gene is significantly up-regulated in two cases of primary colon cancer.
Product Categories/Family for anti-FZD10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
frizzled-10
NCBI Official Synonym Full Names
frizzled class receptor 10
NCBI Official Symbol
FZD10
NCBI Official Synonym Symbols
Fz10; FzE7; CD350; FZ-10; hFz10
NCBI Protein Information
frizzled-10
UniProt Protein Name
Frizzled-10
UniProt Gene Name
FZD10
UniProt Synonym Gene Names
Fz-10; hFz10
UniProt Entry Name
FZD10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The FZD10 fzd10 (Catalog #AAA198854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FZD10 Antibody reacts with Cow, Dog, Horse, Human, Mouse, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's FZD10 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence). Researchers should empirically determine the suitability of the FZD10 fzd10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GMWIWTSKTL QSWQQVCSRR LKKKSRRKPA SVITSGGIYK KAQHPQKTHH. It is sometimes possible for the material contained within the vial of "FZD10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.