Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282328_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human placenta using GAB1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit anti-Human GAB1 Polyclonal Antibody | anti-GAB1 antibody

GAB1 Rabbit pAb

Gene Names
YUC1; L23H3.20; L23H3_20; YUC; YUCCA; YUCCA 1
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity purification
Synonyms
GAB1, Antibody; GAB1 Rabbit pAb; GAB1; GRB2; anti-GAB1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
KHFCRLPLLDFPEYYPKYPSKNEFLAYLESYASHFRIAPRFNKNVQNAAYDSSSGFWRVKTHDNTEYLSKWLIVATGENADPYFPEIPGRKKFSGGKIVHASEYKSGEEFRRQKVLVVGCGNSGMEISLDLVRHNASPHLVVRNTVHVLPR
Applicable Applications for anti-GAB1 antibody
IHC (Immunohistochemistry)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human GAB1 (NP_997006.1).
Cellular Location
cell-cell junction, cytoplasm, cytosol
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human placenta using GAB1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282328_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human placenta using GAB1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using GAB1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282328_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using GAB1 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)
Related Product Information for anti-GAB1 antibody
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,018 Da
NCBI Official Full Name
Flavin-binding monooxygenase family protein
NCBI Official Symbol
YUC1
NCBI Official Synonym Symbols
L23H3.20; L23H3_20; YUC; YUCCA; YUCCA 1
NCBI Protein Information
Flavin-binding monooxygenase family protein
UniProt Protein Name
Probable indole-3-pyruvate monooxygenase YUCCA1
UniProt Gene Name
YUC1
UniProt Synonym Gene Names
YUC; YUCCA; YUCCA1

Similar Products

Product Notes

The GAB1 yuc1 (Catalog #AAA282328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAB1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAB1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GAB1 yuc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KHFCRLPLLD FPEYYPKYPS KNEFLAYLES YASHFRIAPR FNKNVQNAAY DSSSGFWRVK THDNTEYLSK WLIVATGENA DPYFPEIPGR KKFSGGKIVH ASEYKSGEEF RRQKVLVVGC GNSGMEISLD LVRHNASPHL VVRNTVHVLP R. It is sometimes possible for the material contained within the vial of "GAB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.