WB (Western Blot)
(Host: RatTarget Name: GABBR1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
Rabbit anti-Human GABBR1 Polyclonal Antibody | anti-GABBR1 antibody
GABBR1 Antibody - C-terminal region
Gene Names
GABBR1; GB1; GPRC3A; GABABR1; GABBR1-3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GABBR1, Antibody; GABBR1 Antibody - C-terminal region; anti-GABBR1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSEL
Sequence Length
808
Applicable Applications for anti-GABBR1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GABBR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RatTarget Name: GABBR1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RatTarget Name: GABBR1Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GABBR1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GABBR1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GABBR1 antibody
This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined.
Product Categories/Family for anti-GABBR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
88 kDa
NCBI Official Full Name
gamma-aminobutyric acid type B receptor subunit 1 isoform a
NCBI Official Synonym Full Names
gamma-aminobutyric acid type B receptor subunit 1
NCBI Official Symbol
GABBR1
NCBI Official Synonym Symbols
GB1; GPRC3A; GABABR1; GABBR1-3
NCBI Protein Information
gamma-aminobutyric acid type B receptor subunit 1
Similar Products
Product Notes
The GABBR1 (Catalog #AAA201592) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABBR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GABBR1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GABBR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGEWQSEAQD TMKTGSSTNN NEEEKSRLLE KENRELEKII AEKEERVSEL. It is sometimes possible for the material contained within the vial of "GABBR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.