Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201765_WB11.jpg WB (Western Blot) (WB Suggested Anti-GABPA Antibody Titration: 0.5-1.0ug/mlPositive Control: Jurkat cell lysateGABPA is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit GABPA Polyclonal Antibody | anti-GABPA antibody

GABPA antibody - C-terminal region

Gene Names
GABPA; NFT2; NRF2; NRF2A; E4TF1A; E4TF1-60; RCH04A07
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GABPA, Antibody; GABPA antibody - C-terminal region; anti-GABPA antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
Sequence Length
454
Applicable Applications for anti-GABPA antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GABPA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GABPA Antibody Titration: 0.5-1.0ug/mlPositive Control: Jurkat cell lysateGABPA is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA201765_WB11.jpg WB (Western Blot) (WB Suggested Anti-GABPA Antibody Titration: 0.5-1.0ug/mlPositive Control: Jurkat cell lysateGABPA is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: MouseTarget Name: GABPASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA201765_WB13.jpg WB (Western Blot) (Host: MouseTarget Name: GABPASample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA201765_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-GABPA antibody
This is a rabbit polyclonal antibody against GABPA. It was validated on Western Blot and immunohistochemistry

Target Description: GA Binding Protein . chain (GABP-. subunit, GABPA, nuclear respiratory factor-2 subunit . transcription factor E4TF1-60) is one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is likely involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. This subunit also shares identity with a subunit constituting the transcription factor E4TF1, responsible for expression of the adenovirus E4 gene. Because of its chromosomal localization and ability to form heterodimers with other polypeptides, this gene may play a role in the Down Syndrome phenotype.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
GA-binding protein alpha chain
NCBI Official Synonym Full Names
GA binding protein transcription factor subunit alpha
NCBI Official Symbol
GABPA
NCBI Official Synonym Symbols
NFT2; NRF2; NRF2A; E4TF1A; E4TF1-60; RCH04A07
NCBI Protein Information
GA-binding protein alpha chain
UniProt Protein Name
GA-binding protein alpha chain
UniProt Gene Name
GABPA
UniProt Synonym Gene Names
E4TF1A; GABP subunit alpha
UniProt Entry Name
GABPA_HUMAN

Similar Products

Product Notes

The GABPA gabpa (Catalog #AAA201765) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABPA antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GABPA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GABPA gabpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KWGQRKNKPT MNYEKLSRAL RYYYDGDMIC KVQGKRFVYK FVCDLKTLIG. It is sometimes possible for the material contained within the vial of "GABPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.