Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201714_WB11.jpg WB (Western Blot) (WB Suggested Anti-GABRD AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat/HepG2)

Rabbit GABRD Polyclonal Antibody | anti-GABRD antibody

GABRD antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GABRD; EJM7; EIG10; GEFSP5
Reactivity
Cow, Dog, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
GABRD, Antibody; GABRD antibody - N-terminal region; anti-GABRD antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
Sequence Length
452
Applicable Applications for anti-GABRD antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABRD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GABRD AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat/HepG2)

product-image-AAA201714_WB11.jpg WB (Western Blot) (WB Suggested Anti-GABRD AntibodyTitration: 5.0 ug/mlPositive Control: Jurkat/HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: GABRDSample Tissue: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

product-image-AAA201714_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRDSample Tissue: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GABRDSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201714_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: GABRDSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-GABRD antibody
This is a rabbit polyclonal antibody against GABRD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
Product Categories/Family for anti-GABRD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit delta
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor delta subunit
NCBI Official Symbol
GABRD
NCBI Official Synonym Symbols
EJM7; EIG10; GEFSP5
NCBI Protein Information
gamma-aminobutyric acid receptor subunit delta
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit delta
UniProt Gene Name
GABRD
UniProt Entry Name
GBRD_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GABRD gabrd (Catalog #AAA201714) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRD antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GABRD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GABRD gabrd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDAPARLLAP LLLLCAQQLR GTRAMNDIGD YVGSNLEISW LPNLDGLIAG. It is sometimes possible for the material contained within the vial of "GABRD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.