Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199779_WB10.jpg WB (Western Blot) (WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Rabbit GALNAC4S-6ST Polyclonal Antibody | anti-CHST15 antibody

GALNAC4S-6ST antibody - middle region

Gene Names
CHST15; BRAG; GALNAC4S-6ST
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GALNAC4S-6ST, Antibody; GALNAC4S-6ST antibody - middle region; anti-CHST15 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKS
Sequence Length
561
Applicable Applications for anti-CHST15 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GALNAC4S-6ST
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

product-image-AAA199779_WB10.jpg WB (Western Blot) (WB Suggested Anti-GALNAC4S-6ST Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CHST15Sample Type: MCF7Antibody Dilution: 1.0ug/mlCHST15 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA199779_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CHST15Sample Type: MCF7Antibody Dilution: 1.0ug/mlCHST15 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: CHST15Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199779_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CHST15Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: CHST15Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA199779_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: CHST15Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CHST15 antibody
This is a rabbit polyclonal antibody against GALNAC4S-6ST. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GALNAC4S-6ST is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO(4)) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. GALNAC4S-6ST may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression; however such results are unclear in vivo.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
carbohydrate sulfotransferase 15 isoform 1
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 15
NCBI Official Symbol
CHST15
NCBI Official Synonym Symbols
BRAG; GALNAC4S-6ST
NCBI Protein Information
carbohydrate sulfotransferase 15
UniProt Protein Name
Carbohydrate sulfotransferase 15
UniProt Gene Name
CHST15
UniProt Synonym Gene Names
BRAG; GALNAC4S6ST; KIAA0598; hBRAG; GalNAc4S-6ST
UniProt Entry Name
CHSTF_HUMAN

Similar Products

Product Notes

The CHST15 chst15 (Catalog #AAA199779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GALNAC4S-6ST antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GALNAC4S-6ST can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CHST15 chst15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDNSTDGEPP FLTQDFIHAF QPNARLIVML RDPVERLYSD YLYFASSNKS. It is sometimes possible for the material contained within the vial of "GALNAC4S-6ST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.