Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200833_WB10.jpg WB (Western Blot) (WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji)

Rabbit GAPDH Polyclonal Antibody | anti-GAPDH antibody

GAPDH antibody - middle region

Gene Names
GAPDH; G3PD; GAPD; HEL-S-162eP
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GAPDH, Antibody; GAPDH antibody - middle region; anti-GAPDH antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
Sequence Length
335
Applicable Applications for anti-GAPDH antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 90%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GAPDH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji)

product-image-AAA200833_WB10.jpg WB (Western Blot) (WB Suggested Anti-GAPDH antibody Titration: 1 ug/mLSample Type: Human Raji)

WB (Western Blot)

(WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)

product-image-AAA200833_WB11.jpg WB (Western Blot) (WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)

WB (Western Blot)

(Lanes:1) 10 ug2) 20 ug3) 40 ug U87 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:HRP-goat anti-rabbit IgG(H+L) antibodySecondary Antibody Dilution:1: 15000Gene Name:GAPDHSubmitted by:Prof. Varda Shushan-Barmatz, Ben-Gurion UniversityThere is BioGPS gene expression data showing that GAPDH is expressed in U87)

product-image-AAA200833_WB13.jpg WB (Western Blot) (Lanes:1) 10 ug2) 20 ug3) 40 ug U87 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:HRP-goat anti-rabbit IgG(H+L) antibodySecondary Antibody Dilution:1: 15000Gene Name:GAPDHSubmitted by:Prof. Varda Shushan-Barmatz, Ben-Gurion UniversityThere is BioGPS gene expression data showing that GAPDH is expressed in U87)

WB (Western Blot)

(Host: MouseTarget Name: GAPDHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

product-image-AAA200833_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: GAPDHSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-GAPDH antibody
This is a rabbit polyclonal antibody against GAPDH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a
Product Categories/Family for anti-GAPDH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
glyceraldehyde-3-phosphate dehydrogenase isoform 1
NCBI Official Synonym Full Names
glyceraldehyde-3-phosphate dehydrogenase
NCBI Official Symbol
GAPDH
NCBI Official Synonym Symbols
G3PD; GAPD; HEL-S-162eP
NCBI Protein Information
glyceraldehyde-3-phosphate dehydrogenase
UniProt Protein Name
Glyceraldehyde-3-phosphate dehydrogenase
UniProt Gene Name
GAPDH
UniProt Synonym Gene Names
GAPD; GAPDH
UniProt Entry Name
G3P_HUMAN

Similar Products

Product Notes

The GAPDH gapdh (Catalog #AAA200833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAPDH antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAPDH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GAPDH gapdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAGAHLQGGA KRVIISAPSA DAPMFVMGVN HEKYDNSLKI ISNASCTTNC. It is sometimes possible for the material contained within the vial of "GAPDH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.