Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162485_IHC10.jpg IHC (Immunohistochemistry) (GATA6 Antibody-Anti-GATA6 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

Rabbit anti-Human GATA6 Polyclonal Antibody | anti-GATA6 antibody

GATA6 Rabbit anti-Human Polyclonal (C-Terminus) Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Immunogen affinity purified
Synonyms
GATA6, Antibody; GATA6 Rabbit anti-Human Polyclonal (C-Terminus) Antibody; GATA6 Antibody (C-Terminus); GATA6; GATA-binding factor 6; GATA-binding protein 6; GATA binding protein 6; Transcription factor GATA-6; anti-GATA6 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human GATA6
Purity/Purification
Immunogen affinity purified
Form/Format
PBS, 0.09% sodium azide, 2% sucrose
Concentration
0.5mg/ml (varies by lot)
Applicable Applications for anti-GATA6 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human GATA6
Immunogen
Synthetic peptide within the region SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS of human GATA6(Q92908, NP_005248).
Conjugation
Unconjugated
Epitope
C-Terminus
Preparation and Storage
Short term: Store at 2-8 degree C for up to 1 week. Long term: Aliquot and store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(GATA6 Antibody-Anti-GATA6 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162485_IHC10.jpg IHC (Immunohistochemistry) (GATA6 Antibody-Anti-GATA6 antibody IHC of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

IHC (Immunohistochemisry)

(GATA6 Antibody-Anti-GATA6 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162485_IHC11.jpg IHC (Immunohistochemisry) (GATA6 Antibody-Anti-GATA6 antibody IHC of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

IHC (Immunohiostchemistry)

(GATA6 Antibody-Anti-GATA6 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162485_IHC13.jpg IHC (Immunohiostchemistry) (GATA6 Antibody-Anti-GATA6 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

WB (Western Blot)

(GATA6 Antibody-GATA6 antibody Western blot of MCF7 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162485_WB15.jpg WB (Western Blot) (GATA6 Antibody-GATA6 antibody Western blot of MCF7 cell lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)
Related Product Information for anti-GATA6 antibody
GATA6 antibody is an unconjugated rabbit polyclonal antibody to human GATA6 (C-Terminus). Validated for IHC and WB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,033 Da
NCBI Official Full Name
transcription factor GATA-6
NCBI Official Synonym Full Names
GATA binding protein 6
NCBI Official Symbol
GATA6
NCBI Protein Information
transcription factor GATA-6; GATA-binding factor 6
UniProt Protein Name
Transcription factor GATA-6
UniProt Gene Name
GATA6
UniProt Entry Name
GATA6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GATA6 gata6 (Catalog #AAA162485) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA6 Rabbit anti-Human Polyclonal (C-Terminus) Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GATA6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GATA6 gata6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.