Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23555_WB6.jpg WB (Western Blot) (WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit GCLC Polyclonal Antibody | anti-GCLC antibody

GCLC antibody - N-terminal region

Gene Names
GCLC; GCL; GCS; GLCL; GLCLC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GCLC, Antibody; GCLC antibody - N-terminal region; anti-GCLC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
Sequence Length
637
Applicable Applications for anti-GCLC antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

product-image-AAA23555_WB6.jpg WB (Western Blot) (WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

WB (Western Blot)

(WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

product-image-AAA23555_WB5.jpg WB (Western Blot) (WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml.A: - blocking peptide.B: + blocking peptide.)

WB (Western Blot)

(Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate, 3: 40ug mouse heart lysate, 4: 40ug mouse heart lysate, 5: 40ug mouse heart lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GCLCSubmitted by:Anonymous)

product-image-AAA23555_WB4.jpg WB (Western Blot) (Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate, 3: 40ug mouse heart lysate, 4: 40ug mouse heart lysate, 5: 40ug mouse heart lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GCLCSubmitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: GCLCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23555_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GCLCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GCLCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

product-image-AAA23555_WB2.jpg WB (Western Blot) (Host: MouseTarget Name: GCLCSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(GCLC antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

product-image-AAA23555_IHC.jpg IHC (Immunohistochemistry) (GCLC antibody - N-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissuePrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GCLC antibody
This is a rabbit polyclonal antibody against GCLC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
glutamate--cysteine ligase catalytic subunit isoform a
NCBI Official Synonym Full Names
glutamate-cysteine ligase catalytic subunit
NCBI Official Symbol
GCLC
NCBI Official Synonym Symbols
GCL; GCS; GLCL; GLCLC
NCBI Protein Information
glutamate--cysteine ligase catalytic subunit
UniProt Protein Name
Glutamate--cysteine ligase catalytic subunit
UniProt Gene Name
GCLC
UniProt Synonym Gene Names
GLCL; GLCLC
UniProt Entry Name
GSH1_HUMAN

Similar Products

Product Notes

The GCLC gclc (Catalog #AAA23555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCLC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GCLC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GCLC gclc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLETLQEKGE RTNPNHPTLW RPEYGSYMIE GTPGQPYGGT MSEFNTVEAN. It is sometimes possible for the material contained within the vial of "GCLC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.