Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200389_SDS_PAGE8.jpg SDS-PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1ug/ml of the antibody was used in this expirament.)

Rabbit GCLM Polyclonal Antibody | anti-GCLM antibody

GCLM antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
GCLM; GLCLR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GCLM, Antibody; GCLM antibody - middle region; anti-GCLM antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Sequence Length
274
Applicable Applications for anti-GCLM antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GCLM
Protein Size (#AA)
274 amino acids
Protein Interactions
UBC; NAGK; GLRX3; GNAI2; GGLC; STOX1; IRF7; CALM1; SORD; CUL3
Blocking Peptide
For anti-GCLM (MBS3211771) antibody is ( )
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

SDS-PAGE

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1ug/ml of the antibody was used in this expirament.)

product-image-AAA200389_SDS_PAGE8.jpg SDS-PAGE (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1ug/ml of the antibody was used in this expirament.)

WB (Western Blot)

(WB Suggested Anti-GCLM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

product-image-AAA200389_WB10.jpg WB (Western Blot) (WB Suggested Anti-GCLM Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

WB (Western Blot)

(Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse skeletal muscle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GCLMSubmitted by:Anonymous)

product-image-AAA200389_WB11.jpg WB (Western Blot) (Lanes:1: 40ug mouse heart lysate, 2: 40ug mouse skeletal muscle lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10000Gene Name:GCLMSubmitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: GCLMSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200389_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GCLMSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human LiverAnti-GCLM antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. GCLM Antibody concentration 5 ug/ml.)

product-image-AAA200389_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human LiverAnti-GCLM antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. GCLM Antibody concentration 5 ug/ml.)
Related Product Information for anti-GCLM antibody
This is a rabbit polyclonal antibody against GCLM. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
glutamate--cysteine ligase regulatory subunit isoform 1
NCBI Official Synonym Full Names
glutamate-cysteine ligase modifier subunit
NCBI Official Symbol
GCLM
NCBI Official Synonym Symbols
GLCLR
NCBI Protein Information
glutamate--cysteine ligase regulatory subunit
UniProt Protein Name
Glutamate--cysteine ligase regulatory subunit
UniProt Gene Name
GCLM
UniProt Synonym Gene Names
GLCLR
UniProt Entry Name
GSH0_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GCLM gclm (Catalog #AAA200389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCLM antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GCLM can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GCLM gclm for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPNSNQVNLA SCCVMPPDLT AFAKQFDIQL LTHNDPKELL SEASFQEALQ. It is sometimes possible for the material contained within the vial of "GCLM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.