Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201767_WB8.jpg WB (Western Blot) (WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Human Placenta)

Rabbit anti-Human GCM1 Polyclonal Antibody | anti-GCM1 antibody

GCM1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
GCM1; GCMA; hGCMa
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GCM1, Antibody; GCM1 antibody - N-terminal region; anti-GCM1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
Sequence Length
436
Applicable Applications for anti-GCM1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 78%; Human: 92%; Mouse: 78%; Rat: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Human Placenta)

product-image-AAA201767_WB8.jpg WB (Western Blot) (WB Suggested Anti-GCM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:7812500Positive Control: Human Placenta)

WB (Western Blot)

(Human 293T)

product-image-AAA201767_WB10.jpg WB (Western Blot) (Human 293T)

WB (Western Blot)

(Host: RabbitTarget Name: GCM1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA201767_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: GCM1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Human Spleen)

product-image-AAA201767_IHC13.jpg IHC (Immunohiostchemistry) (Human Spleen)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA201767_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-GCM1 antibody
This is a rabbit polyclonal antibody against GCM1. It was validated on Western Blot and immunohistochemistry

Target Description: GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein.This gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-132 D88613.1 1-132 133-2763 AB026493.1 1-2631

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
chorion-specific transcription factor GCMa
NCBI Official Synonym Full Names
glial cells missing transcription factor 1
NCBI Official Symbol
GCM1
NCBI Official Synonym Symbols
GCMA; hGCMa
NCBI Protein Information
chorion-specific transcription factor GCMa
UniProt Protein Name
Chorion-specific transcription factor GCMa
UniProt Gene Name
GCM1
UniProt Synonym Gene Names
GCMA; hGCMa
UniProt Entry Name
GCM1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GCM1 gcm1 (Catalog #AAA201767) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCM1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCM1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GCM1 gcm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEPDDFDSED KEILSWDIND VKLPQNVKKT DWFQEWPDSY AKHIYSSEDK. It is sometimes possible for the material contained within the vial of "GCM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.