Rabbit GCNT3 Polyclonal Antibody | anti-GCNT3 antibody
GCNT3 antibody - C-terminal region
Gene Names
GCNT3; GNTM; C24GNT; C2GNT2; C2GNTM; C2/4GnT
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GCNT3, Antibody; GCNT3 antibody - C-terminal region; anti-GCNT3 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
Applicable Applications for anti-GCNT3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Protein Size (# AA)
438 amino acids
Protein Interactions
DHRSX; RBM18; SNUPN; CASK;
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT3
Replacement Item
This antibody may replace item sc-112929, HPA011154
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 100%; Guinea Pig: 91%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Yeast: 89%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-GCNT3 antibody
This is a rabbit polyclonal antibody against GCNT3. It was validated on Western Blot and immunohistochemistry
Target Description: This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.
Target Description: This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.
Product Categories/Family for anti-GCNT3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
NCBI Official Synonym Full Names
glucosaminyl (N-acetyl) transferase 3, mucin type
NCBI Official Symbol
GCNT3
NCBI Official Synonym Symbols
GNTM; C24GNT; C2GNT2; C2GNTM; C2/4GnT
NCBI Protein Information
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
UniProt Protein Name
Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
UniProt Gene Name
GCNT3
UniProt Synonym Gene Names
C2GnT-M; hC2GnT-M; C2/4GnT
UniProt Entry Name
GCNT3_HUMAN
Similar Products
Product Notes
The GCNT3 gcnt3 (Catalog #AAA199272) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCNT3 antibody - C-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GCNT3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GCNT3 gcnt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AICVYGAGDL NWMLQNHHLL ANKFDPKVDD NALQCLEEYL RYKAIYGTEL. It is sometimes possible for the material contained within the vial of "GCNT3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
