Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283257_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using GDF15 Rabbit pAb(AAA283257) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Human GDF15 Polyclonal Antibody | anti-GDF15 antibody

GDF15 Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
GDF15, Antibody; GDF15 Rabbit pAb; PDF; MIC1; PLAB; MIC-1; NAG-1; PTGFB; GDF-15; GDF15; anti-GDF15 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Applicable Applications for anti-GDF15 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 197-308 of human GDF15 (NP_004855.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of A549 cells using GDF15 Rabbit pAb(AAA283257) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283257_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A549 cells using GDF15 Rabbit pAb(AAA283257) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Hep G2 cells using GDF15 Rabbit pAb(AAA283257) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283257_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Hep G2 cells using GDF15 Rabbit pAb(AAA283257) at a dilution of 1:100 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)
Related Product Information for anti-GDF15 antibody
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 34kDa
UniProt Protein Name
Growth/differentiation factor 15
UniProt Gene Name
GDF15
UniProt Synonym Gene Names
MIC1; PDF; PLAB; PTGFB; GDF-15; MIC-1; NAG-1; NRG-1
UniProt Entry Name
GDF15_HUMAN

Similar Products

Product Notes

The GDF15 gdf15 (Catalog #AAA283257) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GDF15 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GDF15 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the GDF15 gdf15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARNGDHCPLG PGRCCRLHTV RASLEDLGWA DWVLSPREVQ VTMCIGACPS QFRAANMHAQ IKTSLHRLKP DTVPAPCCVP ASYNPMVLIQ KTDTGVSLQT YDDLLAKDCH CI. It is sometimes possible for the material contained within the vial of "GDF15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.