Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201220_WB15.jpg WB (Western Blot) (WB Suggested Anti-GHSR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit GHSR Polyclonal Antibody | anti-GHSR antibody

GHSR antibody - C-terminal region

Gene Names
GHSR; GHDP
Reactivity
Tested : Human.
Predicted: Human, Mouse, Rat, Cow, Dog, Coat, Guinea Pig, Horse, Rabbit, Sheep.
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GHSR, Antibody; GHSR antibody - C-terminal region; anti-GHSR antibody
Ordering
Host
Rabbit
Reactivity
Tested : Human.
Predicted: Human, Mouse, Rat, Cow, Dog, Coat, Guinea Pig, Horse, Rabbit, Sheep.
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: AAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSIN
Sequence Length
366
Applicable Applications for anti-GHSR antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GHSR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

product-image-AAA201220_WB15.jpg WB (Western Blot) (WB Suggested Anti-GHSR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-GHSR antibody
This is a rabbit polyclonal antibody against GHSR. It was validated on Western Blot

Target Description: This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
growth hormone secretagogue receptor type 1 isoform 1a
NCBI Official Synonym Full Names
growth hormone secretagogue receptor
NCBI Official Symbol
GHSR
NCBI Official Synonym Symbols
GHDP
NCBI Protein Information
growth hormone secretagogue receptor type 1

Similar Products

Product Notes

The GHSR (Catalog #AAA201220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GHSR antibody - C-terminal region reacts with Tested : Human. Predicted: Human, Mouse, Rat, Cow, Dog, Coat, Guinea Pig, Horse, Rabbit, Sheep. and may cross-react with other species as described in the data sheet. AAA Biotech's GHSR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GHSR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAINPILYNI MSKKYRVAVF RLLGFEPFSQ RKLSTLKDES SRAWTESSIN. It is sometimes possible for the material contained within the vial of "GHSR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.