Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198101_WB10.jpg WB (Western Blot) (WB Suggested Anti-GJA9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit anti-Dog, Human GJA9 Polyclonal Antibody | anti-GJA9 antibody

GJA9 antibody - middle region

Gene Names
GJA9; CX58; CX59; GJA10
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GJA9, Antibody; GJA9 antibody - middle region; anti-GJA9 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Sequence Length
515
Applicable Applications for anti-GJA9 antibody
WB (Western Blot)
Homology
Dog: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GJA9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GJA9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA198101_WB10.jpg WB (Western Blot) (WB Suggested Anti-GJA9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: GJA9Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

product-image-AAA198101_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA9Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJA9Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA198101_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA9Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GJA9Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA198101_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: GJA9Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GJA9 antibody
This is a rabbit polyclonal antibody against GJA9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits.Connexins, such as GJA9, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-612 BI463634.1 7-618 613-1929 AF271261.1 585-1901 1930-2331 BU689816.1 1-402 c
Product Categories/Family for anti-GJA9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
gap junction alpha-9 protein
NCBI Official Synonym Full Names
gap junction protein alpha 9
NCBI Official Symbol
GJA9
NCBI Official Synonym Symbols
CX58; CX59; GJA10
NCBI Protein Information
gap junction alpha-9 protein
UniProt Protein Name
Gap junction alpha-9 protein
UniProt Gene Name
GJA9
UniProt Synonym Gene Names
GJA10; Cx58; Cx59
UniProt Entry Name
CXA9_HUMAN

Similar Products

Product Notes

The GJA9 gja9 (Catalog #AAA198101) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJA9 antibody - middle region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's GJA9 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GJA9 gja9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDGENNMRQS PQTVFSLPAN CDWKPRWLRA TWGSSTEHEN RGSPPKGNLK. It is sometimes possible for the material contained within the vial of "GJA9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.