Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46728_WB15.jpg WB (Western Blot) (Western blot analysis of Gla expression in mouse thymus extract (lane 1), mouse liver extract (lane 2) and mouse spleen extract (lane 3). Gla at 46KD was detected using rabbit anti- Gla Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Rabbit anti-Mouse Gla Polyclonal Antibody | anti-Gla antibody

Anti-Gla Antibody

Average rating 0.0
No ratings yet
Gene Names
Gla; Ags
Reactivity
Mouse
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Gla, Antibody; Anti-Gla Antibody; Ags; Agalsidase alfa; Alpha D galactosidase A; Alpha gal A; GALA; Galactosidase, alpha; GLA; GLA protein; Melibiase; P06280; Alpha-galactosidase A; galactosidase, alpha; anti-Gla antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
419
Applicable Applications for anti-Gla antibody
WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.
Preparation and Storage
Store at -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Western blot analysis of Gla expression in mouse thymus extract (lane 1), mouse liver extract (lane 2) and mouse spleen extract (lane 3). Gla at 46KD was detected using rabbit anti- Gla Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46728_WB15.jpg WB (Western Blot) (Western blot analysis of Gla expression in mouse thymus extract (lane 1), mouse liver extract (lane 2) and mouse spleen extract (lane 3). Gla at 46KD was detected using rabbit anti- Gla Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-Gla antibody
Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection.
Background: Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.
References
1. "Entrez Gene: GLA galactosidase, alpha".
2. Calhoun DH, Bishop DF, Bernstein HS, Quinn M, Hantzopoulos P, Desnick RJ (1985). "Fabry disease: isolation of a cDNA clone encoding human alpha-galactosidase A". Proceedings of the National Academy of Sciences of the United States of America. 82 (21): 7364-8.
3. Keating GM (October 2012). "Agalsidase alfa: a review of its use in the management of Fabry disease". BioDrugs. 26 (5): 335-54.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Alpha-galactosidase A
NCBI Official Synonym Full Names
galactosidase, alpha
NCBI Official Symbol
Gla
NCBI Official Synonym Symbols
Ags
NCBI Protein Information
alpha-galactosidase A
UniProt Protein Name
Alpha-galactosidase A
UniProt Gene Name
Gla
UniProt Synonym Gene Names
Ags

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Gla gla (Catalog #AAA46728) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Gla Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Gla can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Gla gla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Gla, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.