<
WB (Western Blot)
(WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Rabbit GLIS2 Polyclonal Antibody | anti-GLIS2 antibody
GLIS2 antibody - N-terminal region
Gene Names
GLIS2; NKL; NPHP7
Reactivity
Tested: HumanPredicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GLIS2, Antibody; GLIS2 antibody - N-terminal region; anti-GLIS2 antibody
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish
Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: QDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNE
Sequence Length
524
Applicable Applications for anti-GLIS2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GLIS2
Protein Size (#AA)
524 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-GLIS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: GLIS2Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GLIS2Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GLIS2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GLIS2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
IHC (Immunohistochemistry)
(Sample Type: Human Bile DuctPrimaryDilution: 1:500)
IHC (Immunohistochemistry)
(Sample Type: Human Bile DuctPrimaryDilution: 1:500)
Related Product Information for anti-GLIS2 antibody
This is a rabbit polyclonal antibody against GLIS2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Target Description: Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.
Product Categories/Family for anti-GLIS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
zinc finger protein GLIS2
NCBI Official Synonym Full Names
GLIS family zinc finger 2
NCBI Official Symbol
GLIS2
NCBI Official Synonym Symbols
NKL; NPHP7
NCBI Protein Information
zinc finger protein GLIS2
UniProt Protein Name
Zinc finger protein GLIS2
UniProt Gene Name
GLIS2
UniProt Synonym Gene Names
NKL
UniProt Entry Name
GLIS2_HUMAN
Similar Products
Product Notes
The GLIS2 glis2 (Catalog #AAA197083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLIS2 antibody - N-terminal region reacts with Tested: Human Predicted: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GLIS2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GLIS2 glis2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDLVDHVNDY HVKPEKDAGY CCHWEGCARH GRGFNARYKM LIHIRTHTNE. It is sometimes possible for the material contained within the vial of "GLIS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.