Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281836_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human liver cancer using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit GMIP Polyclonal Antibody | anti-GMIP antibody

GMIP Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
GMIP; ARHGAP46
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
GMIP, Antibody; GMIP Rabbit pAb; ARHGAP46; GMIP; anti-GMIP antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK
Applicable Applications for anti-GMIP antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-91 of human GMIP (NP_057657.2).
Positive Samples
U-87MG, Jurkat, HeLa, Mouse thymus, Mouse spleen, Mouse brain, Rat thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human liver cancer using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281836_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human liver cancer using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat spleen using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281836_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat spleen using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Mouse spleen using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281836_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Mouse spleen using GMIP Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using GMIP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281836_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using GMIP antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-GMIP antibody
Background: This gene encodes a member of the ARHGAP family of Rho/Rac/Cdc42-like GTPase activating proteins. The encoded protein interacts with the Ras-related protein Gem through its N-terminal domain. Separately, it interacts with RhoA through a RhoGAP domain, and stimulates RhoA-dependent GTPase activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Product Categories/Family for anti-GMIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106,683 Da
NCBI Official Full Name
GEM-interacting protein isoform 2
NCBI Official Synonym Full Names
GEM interacting protein
NCBI Official Symbol
GMIP
NCBI Official Synonym Symbols
ARHGAP46
NCBI Protein Information
GEM-interacting protein
UniProt Protein Name
GEM-interacting protein
UniProt Gene Name
GMIP
UniProt Synonym Gene Names
GMIP
UniProt Entry Name
GMIP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GMIP gmip (Catalog #AAA281836) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMIP Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GMIP can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GMIP gmip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDAAEPGLPP GPEGRKRYSD IFRSLDNLEI SLGNVTLEML AGDPLLSEDP EPDKTPTATV TNEASCWSGP SPEGPVPLTG EELDLRLIRT K. It is sometimes possible for the material contained within the vial of "GMIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.