Loading...

Skip to main content

Call us at +1-800-604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (WB Suggested Anti-GNAI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

Rabbit GNAI1 Polyclonal Antibody | anti-GNAI1 antibody

GNAI1 antibody - middle region

Gene Names
GNAI1; Gi
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNAI1, Antibody; GNAI1 antibody - middle region; anti-GNAI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Sequence Length
354
Applicable Applications for anti-GNAI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GNAI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GNAI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

WB (Western Blot) (WB Suggested Anti-GNAI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

WB (Western Blot)

(Host: RatTarget Name: GNAI1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RatTarget Name: GNAI1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GNAI1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: GNAI1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GNAI1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: GNAI1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GNAI1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot) (Host: RabbitTarget Name: GNAI1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GNAI1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot) (Host: MouseTarget Name: GNAI1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)

WB (Western Blot) (Sample Type: human thryoidSample Type: Nthy-ori cell lysate (50ug)Primary Dilution: 1:1000Secondary Antibody: anti-rabbit HRPSecondary Dilution: 1:2000Image Submitted By: Anonymous)
Related Product Information for anti-GNAI1 antibody
This is a rabbit polyclonal antibody against GNAI1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(i) subunit alpha-1 isoform 1
NCBI Official Synonym Full Names
G protein subunit alpha i1
NCBI Official Symbol
GNAI1
NCBI Official Synonym Symbols
Gi
NCBI Protein Information
guanine nucleotide-binding protein G(i) subunit alpha-1
UniProt Protein Name
Guanine nucleotide-binding protein G(i) subunit alpha-1
UniProt Gene Name
GNAI1
UniProt Entry Name
GNAI1_HUMAN

Similar Products

Product Notes

The GNAI1 gnai1 (Catalog #AAA23558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAI1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAI1 gnai1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQLNDSAAYY LNDLDRIAQP NYIPTQQDVL RTRVKTTGIV ETHFTFKDLH. It is sometimes possible for the material contained within the vial of "GNAI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.