WB (Western Blot)
(WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
Rabbit GNL3L Polyclonal Antibody | anti-GNL3L antibody
GNL3L antibody - N-terminal region
Gene Names
GNL3L; GNL3B
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GNL3L, Antibody; GNL3L antibody - N-terminal region; anti-GNL3L antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
Sequence Length
582
Applicable Applications for anti-GNL3L antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
WB (Western Blot)
(WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Lung)
IHC (Immunohistochemistry)
(Rabbit Anti-GNL3L AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, moderate signal, low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
IHC (Immunohistochemistry)
(Rabbit Anti-GNL3L AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Nuclear in hepatocytes, moderate signal, low tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-GNL3L antibody
This is a rabbit polyclonal antibody against GNL3L. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Target Description: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
Product Categories/Family for anti-GNL3L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
guanine nucleotide-binding protein-like 3-like protein
NCBI Official Synonym Full Names
G protein nucleolar 3 like
NCBI Official Symbol
GNL3L
NCBI Official Synonym Symbols
GNL3B
NCBI Protein Information
guanine nucleotide-binding protein-like 3-like protein
UniProt Protein Name
Guanine nucleotide-binding protein-like 3-like protein
UniProt Gene Name
GNL3L
UniProt Entry Name
GNL3L_HUMAN
Similar Products
Product Notes
The GNL3L gnl3l (Catalog #AAA200860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNL3L antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNL3L can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GNL3L gnl3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMKLRHKNKK PGEGSKGHKK ISWPYPQPAK QNGKKATSKV PSAPHFVHPN. It is sometimes possible for the material contained within the vial of "GNL3L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.