WB (Western Blot)
(WB Suggested Anti-GOLGA7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Rabbit GOLGA7 Polyclonal Antibody | anti-GOLGA7 antibody
GOLGA7 antibody - middle region
Gene Names
GOLGA7; GCP16; GOLGA7A; HSPC041; GOLGA3AP1
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GOLGA7, Antibody; GOLGA7 antibody - middle region; anti-GOLGA7 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
Sequence Length
137
Applicable Applications for anti-GOLGA7 antibody
WB (Western Blot)
Protein Size (# AA)
137 amino acids
Protein Interactions
UBC; PPP1CC; GOLGA3;
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GOLGA7
Blocking Peptide
For anti-GOLGA7 (MBS3213027) antibody is Catalog # MBS3237972
Predicted Homology Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Replacement Item
This antibody may replace item sc-101278 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GOLGA7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
WB (Western Blot)
(WB Suggested Anti-GOLGA7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HT1080 cell lysate)
Related Product Information for anti-GOLGA7 antibody
This is a rabbit polyclonal antibody against GOLGA7. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Target Description: GOLGA7 may be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Product Categories/Family for anti-GOLGA7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
golgin subfamily A member 7 isoform a
NCBI Official Synonym Full Names
golgin A7
NCBI Official Symbol
GOLGA7
NCBI Official Synonym Symbols
GCP16; GOLGA7A; HSPC041; GOLGA3AP1
NCBI Protein Information
golgin subfamily A member 7
UniProt Protein Name
Golgin subfamily A member 7
UniProt Gene Name
GOLGA7
UniProt Synonym Gene Names
GCP16
UniProt Entry Name
GOGA7_HUMAN
Similar Products
Product Notes
The GOLGA7 golga7 (Catalog #AAA200666) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLGA7 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GOLGA7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GOLGA7 golga7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACLTAYTIFL CMETHYEKVL KKVSKYIQEQ NEKIYAPQGL LLTDPIERGL. It is sometimes possible for the material contained within the vial of "GOLGA7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.