Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282400_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and GPLD1 Rabbit pAb knockdown (KD) 293T cells, using GPLD1 Rabbit pAb antibody (AAA282400) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)

Rabbit anti-Human GPLD1 Polyclonal Antibody | anti-GPLD1 antibody

[KD Validated] GPLD1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
GPLD1; PLD; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
GPLD1, Antibody; [KD Validated] GPLD1 Rabbit pAb; PLD; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1; anti-GPLD1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
CGLSTHVEIGHRALEFLQLHNGRVNYRELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYIRENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDFHGSYSEAHSA
Applicable Applications for anti-GPLD1 antibody
WB (Western Blot)
Positive Samples
293T, Daudi
Cellular Location
Secreted
Research Area
Cardiovascular, Blood, Serum Proteins
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 24-160 of human GPLD1 (NP_001494.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

WB (Western Blot)

(Western blot analysis of extracts from wild type(WT) and GPLD1 Rabbit pAb knockdown (KD) 293T cells, using GPLD1 Rabbit pAb antibody (AAA282400) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)

product-image-AAA282400_WB13.jpg WB (Western Blot) (Western blot analysis of extracts from wild type(WT) and GPLD1 Rabbit pAb knockdown (KD) 293T cells, using GPLD1 Rabbit pAb antibody (AAA282400) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)

WB (Western Blot)

(Western blot analysis of Daudi, using GPLD1 Rabbit pAb antibody (AAA282400) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)

product-image-AAA282400_WB15.jpg WB (Western Blot) (Western blot analysis of Daudi, using GPLD1 Rabbit pAb antibody (AAA282400) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)
Related Product Information for anti-GPLD1 antibody
Many proteins are tethered to the extracellular face of eukaryotic plasma membranes by a glycosylphosphatidylinositol (GPI) anchor. The GPI-anchor is a glycolipid found on many blood cells. The protein encoded by this gene is a GPI degrading enzyme. Glycosylphosphatidylinositol specific phospholipase D1 hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans, thereby releasing the attached protein from the plasma membrane.
Product Categories/Family for anti-GPLD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
840
NCBI Official Full Name
Phosphatidylinositol-glycan-specific phospholipase D
NCBI Official Synonym Full Names
glycosylphosphatidylinositol specific phospholipase D1
NCBI Official Symbol
GPLD1
NCBI Official Synonym Symbols
PLD; GPIPLD; PIGPLD; GPIPLDM; PIGPLD1
NCBI Protein Information
phosphatidylinositol-glycan-specific phospholipase D; GPI-PLD; PI-G PLD; GPI-specific phospholipase D; glycoprotein phospholipase D; glycosylphosphatidylinositol specific phospholipase D1, isoform 2
UniProt Protein Name
Phosphatidylinositol-glycan-specific phospholipase D
UniProt Gene Name
GPLD1
UniProt Synonym Gene Names
PIGPLD1; PI-G PLD; GPI-PLD; GPI-specific phospholipase D
UniProt Entry Name
PHLD_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPLD1 gpld1 (Catalog #AAA282400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] GPLD1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPLD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GPLD1 gpld1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CGLSTHVEIG HRALEFLQLH NGRVNYRELL LEHQDAYQAG IVFPDCFYPS ICKGGKFHDV SESTHWTPFL NASVHYIREN YPLPWEKDTE KLVAFLFGIT SHMAADVSWH SLGLEQGFLR TMGAIDFHGS YSEAHSA. It is sometimes possible for the material contained within the vial of "GPLD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.